PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002090P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 292aa    MW: 32719.3 Da    PI: 6.8541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002090P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-172875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll++ + ++G g+W++ a++ g++Rt+k+c++rw++yl
   MELO3C002090P1 28 RGPWTLEEDNLLIHSISLHGEGRWNLLAKRSGLRRTGKSCRLRWLNYL 75
                     89********************************************97 PP

2Myb_DNA-binding51.13.2e-1681124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
   MELO3C002090P1  81 RGNLSAQEQLLILDLHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 124
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.9172379IPR017930Myb domain
SuperFamilySSF466892.38E-2926122IPR009057Homeodomain-like
SMARTSM007171.0E-152777IPR001005SANT/Myb domain
PfamPF002497.6E-162875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-212982IPR009057Homeodomain-like
CDDcd001676.45E-123075No hitNo description
PROSITE profilePS5129419.74880130IPR017930Myb domain
SMARTSM007171.8E-1480128IPR001005SANT/Myb domain
PfamPF002499.9E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2283129IPR009057Homeodomain-like
CDDcd001677.61E-1185124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSSSSPKSFG SCSEIEDDNS NNGNELRRGP WTLEEDNLLI HSISLHGEGR WNLLAKRSGL  60
RRTGKSCRLR WLNYLKPDVK RGNLSAQEQL LILDLHSKWG NRWSKIAQHL PGRTDNEIKN  120
YWRTRVQKQA RHLNIDTNSE AFQQIIRSYW IPRLIQKINQ SPPSELPITS PPEMASQTSF  180
GFEAPTTAVA QPSAVTPLQI GGDLMGSSCS SSSSSHITQI SSFQNYENFA PFVKDYYHDG  240
GHGGGEMLNW ATTAVAGDSG YPVSHCHVAE NNWMESDFTG YMSNVDELWQ F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-24251301105MYB PROTO-ONCOGENE PROTEIN
1a5j_A2e-24251304108B-MYB
1h8a_C4e-242513024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAPTransfer from AT1G25340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458430.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0A0LQS61e-160A0A0A0LQS6_CUCSA; Uncharacterized protein
STRINGPOPTR_0012s05200.13e-96(Populus trichocarpa)
STRINGPOPTR_0015s03770.14e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.12e-78myb domain protein 116